PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02553.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 327aa    MW: 36767.8 Da    PI: 5.8971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02553.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ +v+ +G g W+t + + g++R++k+c++rw +yl
  Rsa1.0_02553.1_g00001.1 14 KGAWTQEEDQKLIAYVQHHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                             79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +++ E++ ++++++ +G++ W++Iar+++ gRt++++k++w+++
  Rsa1.0_02553.1_g00001.1  67 RGEFSQKEEDSIINLHAIHGNK-WSAIARRLP-GRTDNEIKNHWNTH 111
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.783961IPR017930Myb domain
SuperFamilySSF466891.5E-2911108IPR009057Homeodomain-like
SMARTSM007173.4E-131363IPR001005SANT/Myb domain
PfamPF002499.4E-161461IPR001005SANT/Myb domain
CDDcd001671.27E-91661No hitNo description
PROSITE profilePS5129425.54362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-2665117IPR009057Homeodomain-like
SMARTSM007175.2E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1567111IPR001005SANT/Myb domain
CDDcd001672.10E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGAWTQE EDQKLIAYVQ HHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SQKEEDSIIN LHAIHGNKWS AIARRLPGRT DNEIKNHWNT HIKKRLIKKG  120
IDPLTHKSPD HPETLPDKSI GHQEDDDQKS NNNKSLASPS ARFLNKVARF GKRINHSALS  180
IIIGSGGPFT SHTTPTTSAS ECEKSTSSSS TPNSSNLQMI LDATTTPTTS TSTFSNDASA  240
PLMYDNIFDD IDDMTGFSSR FLNDIVSHDD EDFLMLDESC SENTLFTEEL TMILQEDTTE  300
TMFNDSHLKL INEVDDYSFE GIDNWFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894000.0AC189400.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB056L15, complete sequence.
GenBankFJ5843000.0FJ584300.1 Brassica rapa subsp. pekinensis MYB domain protein 122 pseudogene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652381.10.0PREDICTED: transcription factor MYB122-like
SwissprotQ9C9C81e-151MY122_ARATH; Transcription factor MYB122
TrEMBLA0A078CDQ00.0A0A078CDQ0_BRANA; BnaC06g34910D protein
STRINGBra015939.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-143myb domain protein 122